PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ahy014791
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family WRKY
Protein Properties Length: 464aa    MW: 51759 Da    PI: 6.3601
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Ahy#S59552994PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY86.62.3e-27182238360
                -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
       WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                DgynWrKYG K  kg e+prsYYrC+ ++C++kkkv r+  d+k++ i+Y+g+Hnh+k
  Ahy014791 182 DGYNWRKYGEKRTKGGENPRSYYRCAEPNCTMKKKVGRNL-DGKIIAIMYKGNHNHPK 238
                9***************************************.***************85 PP

2WRKY100.21.3e-31319377159
                ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
       WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                ldDgy+WrKYGqK+vkg+++pr+YY+C s+gC+vkk+ver+a+d k v +tYeg+Hnh+
  Ahy014791 319 LDDGYKWRKYGQKVVKGNPNPRNYYKCVSPGCNVKKHVERAADDIKSVMTTYEGKHNHD 377
                59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.1E-24170239IPR003657WRKY domain
PROSITE profilePS5081122.182175239IPR003657WRKY domain
SuperFamilySSF1182907.32E-21178239IPR003657WRKY domain
SMARTSM007746.8E-25180238IPR003657WRKY domain
PfamPF031063.7E-21182237IPR003657WRKY domain
Gene3DG3DSA:2.20.25.804.2E-35304379IPR003657WRKY domain
SuperFamilySSF1182905.62E-28311379IPR003657WRKY domain
PROSITE profilePS5081136.231314379IPR003657WRKY domain
SMARTSM007742.1E-35319378IPR003657WRKY domain
PfamPF031069.7E-24320377IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 464 aa     Download sequence    Send to blast
MSFTTFSGLL SRRYNNTSMV DDNCWETSIP RTGSDDNHGE FFSSIIYPSY SDFPPGFNPN  60
EFLDAFLSES NSLNWRNSSS ENQQSKEEDE KYYSDPSIDV SLLQSSSNIF EEGDPQRKQD  120
TFTILESGML VDFSSPMTNT TNFQDPYLRN FSEMALAVPE IHSTLAPQLN CHKSINEDED  180
GDGYNWRKYG EKRTKGGENP RSYYRCAEPN CTMKKKVGRN LDGKIIAIMY KGNHNHPKPS  240
KPVGSANFPL VNELYASSYT DSVNLNRQSV GGGVENQLGA HTKRLKGGNG IYSYLFPSGG  300
KAIKEPRVVV QTTTEIDILD DGYKWRKYGQ KVVKGNPNPR NYYKCVSPGC NVKKHVERAA  360
DDIKSVMTTY EGKHNHDVPQ ERSSFASRIA SLTNNFATPS SSSSLPLHDT SLSLSSPRAN  420
NENQASQELT TLPFIVGIPN FGRSLIGTSY ANEGPSSNNE EKKD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-36182379878Probable WRKY transcription factor 4
2lex_A3e-36182379878Probable WRKY transcription factor 4
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016184033.10.0PREDICTED: probable WRKY transcription factor 26
SwissprotQ8S8P51e-69WRK33_ARATH; Probable WRKY transcription factor 33
TrEMBLA0A0B2SKP51e-102A0A0B2SKP5_GLYSO; Putative WRKY transcription factor 33
STRINGGLYMA01G31921.11e-101(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38470.14e-69WRKY DNA-binding protein 33